Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_1044_iso_10
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family VOZ
Protein Properties Length: 475aa    MW: 52882.2 Da    PI: 5.6818
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                   VOZ   1 pppsaflgpkcalwdctrpaqgsewl...qdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakv 70 
                                           ppp+aflgpkcalwdc+rpaq  ew+   qdycss+hat+a  eg pg++pvlrp+gi+lkd+llfaalsak+
                                           89***********************944459****************************************** PP

                                   VOZ  71 qgkevgipecegaatakspwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkq 143
                                           ************************************************************************* PP

                                   VOZ 144 vmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksakgkvskdsladlqkklgrlt 216
                                           vm+efgglkrsyymdpqp++s+ewhlyeyein++d +alyrlelklvd+kks+kgkv++ds++dlqk++ +lt
                                           ************************************************************************9 PP

                                   VOZ 217 a 217
  cra_locus_1044_iso_10_len_2330_ver_3 415 A 415
                                           7 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011086027.10.0PREDICTED: transcription factor VOZ1-like isoform X1
RefseqXP_011086028.10.0PREDICTED: transcription factor VOZ1-like isoform X1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A068TU110.0A0A068TU11_COFCA; Uncharacterized protein
STRINGVIT_10s0003g00500.t010.0(Vitis vinifera)